BiGG Gene b1064

b1064

grxB

Model: iAF1260b
Position: 1123407 - 1124054
Strand: Minus
Chromosome: NC_000913.3

Protein Sequence

MKLYIYDHCPYCLKARMIFGLKNIPVELHVLLNDDAETPTRMVGQKQVPILQKDDSRYMPESMDIVHYVDKLDGKPLLTGKRSPAIEEWLRKVNGYANKLLLPRFAKSAFDEFSTPAARKYFVDKKEASAGNFADLLAHSDGLIKNISDDLRALDKLIVKPNAVNGELSEDDIQLFPLLRNLTLVAGINWPSRVADYRDNMAKQTQINLLSSMAI

DNA Sequence

GTGAAGCTATACATTTACGATCACTGCCCTTACTGCCTCAAAGCCCGCATGATTTTCGGCCTGAAAAATATCCCCGTCGAATTACATGTTCTGCTCAACGACGACGCAGAAACACCCACCCGGATGGTCGGTCAAAAACAGGTTCCCATTCTGCAAAAAGATGACAGCCGCTATATGCCAGAAAGCATGGACATCGTTCACTATGTCGATAAACTCGACGGCAAACCGTTACTGACCGGCAAACGTTCCCCTGCCATTGAAGAGTGGCTGCGCAAGGTCAATGGCTACGCCAACAAACTGCTGTTGCCGCGTTTTGCCAAATCGGCATTTGATGAGTTTTCTACTCCCGCCGCGCGCAAATATTTCGTCGACAAGAAAGAGGCCAGCGCGGGTAATTTTGCCGACCTGCTGGCCCACTCTGACGGTCTGATTAAGAATATCAGCGATGATTTACGTGCGCTGGACAAACTGATCGTCAAACCGAACGCCGTGAATGGCGAACTTTCGGAAGATGATATTCAGCTATTCCCGCTACTGCGTAATCTGACGCTGGTAGCCGGAATTAACTGGCCAAGCCGCGTTGCTGATTACCGCGATAATATGGCGAAACAGACACAAATCAATTTGTTATCATCAATGGCGATTTAA

Associated reactions

BiGG ID	Name	Gene reaction rule
ASR	arsenate reductase	b3503 and b1064
__iAF1260b__GRXR	glutaredoxin reductase	b3610 or b1064 or b0849 or b1654
__iAF1260b__PAPSR2	phosphoadenylyl-sulfate reductase (glutaredoxin)	(b2762 and b1064) or (b1654 and b2762) or (b3610 and b2762) or (b0849 and b2762)
__iAF1260b__RNDR1b	ribonucleoside-diphosphate reductase (ADP) (glutaredoxin)	((b2675 and b2676) and b3610) or (b0849 and (b2675 and b2676)) or (b1654 and (b2675 and b2676)) or (b1064 and (b2675 and b2676))
__iAF1260b__RNDR2b	ribonucleoside-diphosphate reductase (GDP) (glutaredoxin)	(b3610 and (b2676 and b2675)) or (b0849 and (b2676 and b2675)) or ((b2676 and b2675) and b1654) or (b1064 and (b2676 and b2675))
__iAF1260b__RNDR3b	ribonucleoside-diphosphate reductase (CDP) (glutaredoxin)	(b0849 and (b2676 and b2675)) or ((b2676 and b2675) and b1654) or (b1064 and (b2676 and b2675)) or (b3610 and (b2676 and b2675))
__iAF1260b__RNDR4b	ribonucleoside-diphosphate reductase (UDP) (glutaredoxin)	(b3610 and (b2676 and b2675)) or ((b2676 and b2675) and b1654) or ((b2676 and b2675) and b0849) or ((b2676 and b2675) and b1064)