Gene
b2415

ptsH

Protein Sequence
MFQQEVTITAPNGLHTRPAAQFVKEAKGFTSEITVTSNGKSASAKSLFKLQTLGLTQGTVVTISAEGEDEQKAVEHLVKLMAELE
DNA Sequence
ATGTTCCAGCAAGAAGTTACCATTACCGCTCCGAACGGTCTGCACACCCGCCCTGCTGCCCAGTTTGTAAAAGAAGCTAAGGGCTTCACTTCTGAAATTACTGTGACTTCCAACGGCAAAAGCGCCAGCGCGAAAAGCCTGTTTAAACTGCAGACTCTGGGCCTGACTCAAGGTACCGTTGTGACTATCTCCGCAGAAGGCGAAGACGAGCAGAAAGCGGTTGAACATCTGGTTAAACTGATGGCGGAACTCGAGTAA
Associated reactions
  BiGG ID Name Gene reaction rule
ACGAptspp N-Acetyl-D-glucosamine transport via PEP:Pyr PTS (periplasm) (b2415 and b0679 and b2416) or (b2416 and b2415 and b2417 and b1101)
ACMANAptspp N-acetyl-D-mannosamine transport via PTS (periplasm) b2416 and b2415 and b1819 and b1818 and b1817
ACMUMptspp N-acetylmuramate transport via PEP:Pyr PTS (periplasm) b2429 and b2416 and b2415 and b2417
__iAF1260b__ASCBptspp L-ascorbate transport via PEP:Pyr PTS (periplasm) b4195 and b2416 and b4193 and b2415 and b4194
DHAPT Dihydroxyacetone phosphotransferase b1199 and b1198 and b2415 and b2416 and b1200
FRUpts2pp Fructose transport via PEP:Pyr PTS (f6p generating) (periplasm) b1817 and b2416 and b2415 and b1818 and b1819
FRUptspp D-fructose transport via PEP:Pyr PTS (periplasm) b2416 and b2415 and b2167 and b2169
GALTptspp Galactitol transport via PEP:Pyr PTS (periplasm) b2093 and b2415 and b2416 and b2092 and b2094
GAMptspp D-glucosamine transport via PEP:Pyr PTS (periplasm) b1819 and b1818 and b2416 and b2415 and b1817
GLCptspp D-glucose transport via PEP:Pyr PTS (periplasm) (b1817 and b2416 and b2415 and b1819 and b1818) or (b2417 and b2416 and b2415 and b1101) or (b2415 and b2416 and b2417 and b1621)
MALTptspp maltose transport via PEP:Pyr PTS (periplasm) b2416 and b2415 and b2417 and b1621
MANGLYCptspp 2-O-alpha-mannosyl-D-glycerate transport via PEP:Pyr PTS (periplasm) b2416 and b2415 and b0731
MANptspp D-mannose transport via PEP:Pyr PTS (periplasm) b1818 and b1819 and b2415 and b2416 and b1817
MNLptspp mannitol transport via PEP:Pyr PTS (periplasm) b3599 and b2415 and b2416
SBTptspp D-sorbitol transport via PEP:Pyr PTS (periplasm) b2702 and b2703 and b2704 and b2416 and b2415
SUCptspp sucrose transport via PEP:Pyr (periplasm) b2429 and b2415 and b2416 and b2417
TREptspp trehalose transport via PEP:Pyr PTS (periplasm) b2417 and b2415 and b2416 and b4240