BiGG Gene b0849

b0849

grxA

Model: iJO1366
Position: 890496 - 890753
Strand: Minus
Chromosome: NC_000913.3

Protein Sequence

MQTVIFGRSGCPYCVRAKDLAEKLSNERDDFQYQYVDIRAEGITKEDLQQKAGKPVETVPQIFVDQQHIGGYTDFAAWVKENLDA

DNA Sequence

ATGCAAACCGTTATTTTTGGTCGTTCGGGTTGCCCTTACTGTGTGCGTGCAAAAGATCTGGCTGAGAAATTGAGCAATGAACGCGATGATTTTCAGTATCAGTATGTAGATATTCGTGCGGAAGGGATCACTAAAGAAGATCTACAACAAAAGGCAGGTAAACCCGTAGAAACCGTGCCGCAGATTTTTGTCGATCAGCAACATATCGGCGGCTATACCGATTTTGCTGCATGGGTGAAAGAAAATCTGGACGCCTGA

Associated reactions

BiGG ID	Name	Gene reaction rule
__iJO1366__GRXR	glutaredoxin reductase	b1064 or b3610 or b1654 or b0849
__iJO1366__PAPSR2	phosphoadenylyl-sulfate reductase (glutaredoxin)	(b2762 and b0849) or (b2762 and b1064) or (b2762 and b1654) or (b2762 and b3610)
__iJO1366__RNDR1b	ribonucleoside-diphosphate reductase (ADP) (glutaredoxin)	(b1064 and (b2675 and b2676)) or (b3610 and (b2675 and b2676)) or (b1654 and (b2675 and b2676)) or (b0849 and (b2675 and b2676))
__iJO1366__RNDR2b	ribonucleoside-diphosphate reductase (GDP) (glutaredoxin)	(b0849 and (b2675 and b2676)) or (b3610 and (b2675 and b2676)) or (b1064 and (b2675 and b2676)) or (b1654 and (b2675 and b2676))
__iJO1366__RNDR3b	ribonucleoside-diphosphate reductase (CDP) (glutaredoxin)	(b0849 and (b2675 and b2676)) or (b3610 and (b2675 and b2676)) or (b1654 and (b2675 and b2676)) or (b1064 and (b2675 and b2676))
__iJO1366__RNDR4b	ribonucleoside-diphosphate reductase (UDP) (glutaredoxin)	(b0849 and (b2675 and b2676)) or (b1064 and (b2675 and b2676)) or (b3610 and (b2675 and b2676)) or (b1654 and (b2675 and b2676))