Gene
b2415

ptsH

Protein Sequence
MFQQEVTITAPNGLHTRPAAQFVKEAKGFTSEITVTSNGKSASAKSLFKLQTLGLTQGTVVTISAEGEDEQKAVEHLVKLMAELE
DNA Sequence
ATGTTCCAGCAAGAAGTTACCATTACCGCTCCGAACGGTCTGCACACCCGCCCTGCTGCCCAGTTTGTAAAAGAAGCTAAGGGCTTCACTTCTGAAATTACTGTGACTTCCAACGGCAAAAGCGCCAGCGCGAAAAGCCTGTTTAAACTGCAGACTCTGGGCCTGACTCAAGGTACCGTTGTGACTATCTCCGCAGAAGGCGAAGACGAGCAGAAAGCGGTTGAACATCTGGTTAAACTGATGGCGGAACTCGAGTAA
Associated reactions
  BiGG ID Name Gene reaction rule
ACGAptspp N-Acetyl-D-glucosamine transport via PEP:Pyr PTS (periplasm) (b2417 and b1101 and b2415 and b2416) or (b0679 and b2415 and b2416)
ACMANAptspp N-acetyl-D-mannosamine transport via PTS (periplasm) b1817 and b1818 and b1819 and b2415 and b2416
ACMUMptspp N-acetylmuramate transport via PEP:Pyr PTS (periplasm) b2417 and b2429 and b2415 and b2416
ARBTptspp arbutin transport via PEP:Pyr PTS (periplasm) (b3722 and b2415 and b2416) or (b2715 and b2415 and b2416)
__iJO1366__ASCBptspp L-ascorbate transport via PEP:Pyr PTS (periplasm) b2415 and b2416 and b4195 and b4194 and b4193
DHAPT Dihydroxyacetone phosphotransferase b1200 and b1199 and b1198 and b2415 and b2416
FRUpts2pp Fructose transport via PEP:Pyr PTS (f6p generating) (periplasm) b1817 and b1818 and b1819 and b2415 and b2416
FRUptspp D-fructose transport via PEP:Pyr PTS (periplasm) b2167 and b2169 and b2415 and b2416
GALTptspp Galactitol transport via PEP:Pyr PTS (periplasm) b2094 and b2093 and b2092 and b2415 and b2416
GAMptspp D-glucosamine transport via PEP:Pyr PTS (periplasm) b1817 and b1818 and b1819 and b2415 and b2416
GLCptspp D-glucose transport via PEP:Pyr PTS (periplasm) (b2417 and b1621 and b2415 and b2416) or (b2417 and b1101 and b2415 and b2416) or (b1817 and b1818 and b1819 and b2415 and b2416)
MALTptspp maltose transport via PEP:Pyr PTS (periplasm) b2417 and b1621 and b2415 and b2416
MANGLYCptspp 2-O-alpha-mannosyl-D-glycerate transport via PEP:Pyr PTS (periplasm) b0731 and b2415 and b2416
MANptspp D-mannose transport via PEP:Pyr PTS (periplasm) b1817 and b1818 and b1819 and b2415 and b2416
MNLptspp mannitol transport via PEP:Pyr PTS (periplasm) b3599 and b2415 and b2416
SBTptspp D-sorbitol transport via PEP:Pyr PTS (periplasm) b2415 and b2416 and b2702 and b2704 and b2703
SUCptspp sucrose transport via PEP:Pyr (periplasm) b2417 and b2429 and b2415 and b2416
TREptspp trehalose transport via PEP:Pyr PTS (periplasm) b2417 and b2415 and b2416 and b4240