BiGG Gene b3781

b3781

trxA

Model: iJO1366
Position: 3965761 - 3966090
Strand: Plus
Chromosome: NC_000913.3

Protein Sequence

MSDKIIHLTDDSFDTDVLKADGAILVDFWAEWCGPCKMIAPILDEIADEYQGKLTVAKLNIDQNPGTAPKYGIRGIPTLLLFKNGEVAATKVGALSKGQLKEFLDANLA

DNA Sequence

ATGAGCGATAAAATTATTCACCTGACTGACGACAGTTTTGACACGGATGTACTCAAAGCGGACGGGGCGATCCTCGTCGATTTCTGGGCAGAGTGGTGCGGTCCGTGCAAAATGATCGCCCCGATTCTGGATGAAATCGCTGACGAATATCAGGGCAAACTGACCGTTGCAAAACTGAACATCGATCAAAACCCTGGCACTGCGCCGAAATATGGCATCCGTGGTATCCCGACTCTGCTGCTGTTCAAAAACGGTGAAGTGGCGGCAACCAAAGTGGGTGCACTGTCTAAAGGTCAGTTGAAAGAGTTCCTCGACGCTAACCTGGCGTAA

Associated reactions

BiGG ID	Name	Gene reaction rule
__iJO1366__DSBDR	DsbD reductase	(b4136 and b2582) or (b4136 and b3781)
__iJO1366__METSOXR1	L-methionine-S-oxide reductase	(b4219 and b2582) or (b4219 and b3781) or (b3551 and b2582) or (b3551 and b3781)
__iJO1366__METSOXR2	L-methionine-R-sulfoxide reductase	(b1778 and b2582) or (b1778 and b3781)
__iJO1366__PAPSR	phosphoadenylyl-sulfate reductase (thioredoxin)	(b2762 and b2582) or (b2762 and b3781)
__iJO1366__RNDR1	ribonucleoside-diphosphate reductase (ADP)	((b2234 and b2235) and b2582) or ((b2234 and b2235) and b3781)
__iJO1366__RNDR2	ribonucleoside-diphosphate reductase (GDP)	((b2234 and b2235) and b3781) or ((b2234 and b2235) and b2582)
__iJO1366__RNDR3	ribonucleoside-diphosphate reductase (CDP)	((b2234 and b2235) and b3781) or ((b2234 and b2235) and b2582)
__iJO1366__RNDR4	ribonucleoside-diphosphate reductase (UDP)	((b2234 and b2235) and b3781) or ((b2234 and b2235) and b2582)
__iJO1366__THIORDXi	hydrogen peroxide reductase (thioredoxin)	(b2480 and b3781) or (b2480 and b2582) or b1710
__iJO1366__TRDR	thioredoxin reductase (NADPH)	(b3781 and b0888) or (b0888 and b2582)