BiGG Gene b2415

b2415

ptsH

Model: iJR904
Position: 2533764 - 2534021
Strand: Plus
Chromosome: NC_000913.3

Protein Sequence

MFQQEVTITAPNGLHTRPAAQFVKEAKGFTSEITVTSNGKSASAKSLFKLQTLGLTQGTVVTISAEGEDEQKAVEHLVKLMAELE

DNA Sequence

ATGTTCCAGCAAGAAGTTACCATTACCGCTCCGAACGGTCTGCACACCCGCCCTGCTGCCCAGTTTGTAAAAGAAGCTAAGGGCTTCACTTCTGAAATTACTGTGACTTCCAACGGCAAAAGCGCCAGCGCGAAAAGCCTGTTTAAACTGCAGACTCTGGGCCTGACTCAAGGTACCGTTGTGACTATCTCCGCAGAAGGCGAAGACGAGCAGAAAGCGGTTGAACATCTGGTTAAACTGATGGCGGAACTCGAGTAA

Associated reactions

BiGG ID	Name	Gene reaction rule
ACGApts	N-Acetyl-D-glucosamine transport via PEP:Pyr PTS	(b2415 and b2417 and b2416 and b1101) or (b2415 and b2416 and b0679)
ACMANApts	N-acetyl-D-mannosamine transport via PTS	b2415 and b2416 and b1818 and b1817 and b1819
DHAPT	Dihydroxyacetone phosphotransferase	b2415 and b1200 and b1199 and b2416 and b1198
FRUpts	D-fructose transport via PEP:Pyr PTS	b2415 and b2416 and b2167 and b2169
FRUpts2	Fructose transport via PEP:Pyr PTS (f6p generating)	b2415 and b2416 and b1818 and b1819 and b1817
GALTpts	Galactitol transport via PEP:Pyr PTS	b2415 and b2092 and b2094 and b2416 and b2093
GAMpts	D-glucosamine transport via PEP:Pyr PTS	b2415 and b2416 and b1818 and b1817 and b1819
GLCpts	D-glucose transport via PEP:Pyr PTS	(b2415 and b2417 and b2416 and b1101) or (b2415 and b2416 and b1818 and b1817 and b1819) or (b1621 and b2415 and b2417 and b2416)
MALTpts	maltose transport via PEP:Pyr PTS	b1621 and b2415 and b2417 and b2416 and b4036
MANpts	D-mannose transport via PEP:Pyr PTS	b2415 and b2416 and b1818 and b1819 and b1817
MNLpts	mannitol transport via PEP:Pyr PTS	b2415 and b2416 and b3599
SBTpts	D-sorbitol transport via PEP:Pyr PTS	b2703 and b2415 and b2702 and b2416 and b2704
SUCpts	sucrose transport via PEP:Pyr PTS	b2415 and b2417 and b2429 and b2416
TREpts	trehalose transport via PEP:Pyr PTS	b2415 and b2417 and b2416 and b4240