BiGG Gene b1064

b1064

grxB

Model: iML1515
Position: 1123407 - 1124054
Strand: Minus
Chromosome: NC_000913.3

Protein Sequence

MKLYIYDHCPYCLKARMIFGLKNIPVELHVLLNDDAETPTRMVGQKQVPILQKDDSRYMPESMDIVHYVDKLDGKPLLTGKRSPAIEEWLRKVNGYANKLLLPRFAKSAFDEFSTPAARKYFVDKKEASAGNFADLLAHSDGLIKNISDDLRALDKLIVKPNAVNGELSEDDIQLFPLLRNLTLVAGINWPSRVADYRDNMAKQTQINLLSSMAI

DNA Sequence

GTGAAGCTATACATTTACGATCACTGCCCTTACTGCCTCAAAGCCCGCATGATTTTCGGCCTGAAAAATATCCCCGTCGAATTACATGTTCTGCTCAACGACGACGCAGAAACACCCACCCGGATGGTCGGTCAAAAACAGGTTCCCATTCTGCAAAAAGATGACAGCCGCTATATGCCAGAAAGCATGGACATCGTTCACTATGTCGATAAACTCGACGGCAAACCGTTACTGACCGGCAAACGTTCCCCTGCCATTGAAGAGTGGCTGCGCAAGGTCAATGGCTACGCCAACAAACTGCTGTTGCCGCGTTTTGCCAAATCGGCATTTGATGAGTTTTCTACTCCCGCCGCGCGCAAATATTTCGTCGACAAGAAAGAGGCCAGCGCGGGTAATTTTGCCGACCTGCTGGCCCACTCTGACGGTCTGATTAAGAATATCAGCGATGATTTACGTGCGCTGGACAAACTGATCGTCAAACCGAACGCCGTGAATGGCGAACTTTCGGAAGATGATATTCAGCTATTCCCGCTACTGCGTAATCTGACGCTGGTAGCCGGAATTAACTGGCCAAGCCGCGTTGCTGATTACCGCGATAATATGGCGAAACAGACACAAATCAATTTGTTATCATCAATGGCGATTTAA

Associated reactions

BiGG ID	Name	Gene reaction rule
__iML1515__RNDR3b	ribonucleoside-diphosphate reductase (CDP) (glutaredoxin)	(b0849 and (b2675 and b2676)) or ((b2675 and b2676) and b3610) or ((b2675 and b2676) and b1064) or ((b2675 and b2676) and b1654)
__iML1515__RNDR4b	ribonucleoside-diphosphate reductase (UDP) (glutaredoxin)	(b0849 and (b2675 and b2676)) or ((b2675 and b2676) and b3610) or ((b2675 and b2676) and b1654) or ((b2675 and b2676) and b1064)
__iML1515__PAPSR2	phosphoadenylyl-sulfate reductase (glutaredoxin)	(b3610 and b2762) or (b0849 and b2762) or (b1064 and b2762) or (b1654 and b2762)
__iML1515__GRXR	glutaredoxin reductase	b1064 or b3610 or b1654 or b0849
__iML1515__RNDR1b	ribonucleoside-diphosphate reductase (ADP) (glutaredoxin)	((b2675 and b2676) and b1064) or ((b2675 and b2676) and b3610) or (b0849 and (b2675 and b2676)) or ((b2675 and b2676) and b1654)
__iML1515__RNDR2b	ribonucleoside-diphosphate reductase (GDP) (glutaredoxin)	(b0849 and (b2675 and b2676)) or ((b2675 and b2676) and b1064) or ((b2675 and b2676) and b1654) or ((b2675 and b2676) and b3610)
ASR	arsenate reductase	b1064 and b3503