Gene
b2415

ptsH

Protein Sequence
MFQQEVTITAPNGLHTRPAAQFVKEAKGFTSEITVTSNGKSASAKSLFKLQTLGLTQGTVVTISAEGEDEQKAVEHLVKLMAELE
DNA Sequence
ATGTTCCAGCAAGAAGTTACCATTACCGCTCCGAACGGTCTGCACACCCGCCCTGCTGCCCAGTTTGTAAAAGAAGCTAAGGGCTTCACTTCTGAAATTACTGTGACTTCCAACGGCAAAAGCGCCAGCGCGAAAAGCCTGTTTAAACTGCAGACTCTGGGCCTGACTCAAGGTACCGTTGTGACTATCTCCGCAGAAGGCGAAGACGAGCAGAAAGCGGTTGAACATCTGGTTAAACTGATGGCGGAACTCGAGTAA
Associated reactions
  BiGG ID Name Gene reaction rule
DHAPT Dihydroxyacetone phosphotransferase b1200 and b1198 and b2416 and b2415 and b1199
SUCptspp sucrose transport via PEP:Pyr (periplasm) b2417 and b2415 and b2416 and b2429
TREptspp trehalose transport via PEP:Pyr PTS (periplasm) b2417 and b4240 and b2416 and b2415
ACGAptspp N-Acetyl-D-glucosamine transport via PEP:Pyr PTS (periplasm) (b2416 and b2417 and b2415 and b1101) or (b2415 and b2416 and b0679)
ACMANAptspp N-acetyl-D-mannosamine transport via PTS (periplasm) b2415 and b1818 and b2416 and b1817 and b1819
__iML1515__ASCBptspp L-ascorbate transport via PEP:Pyr PTS (periplasm) b4195 and b4193 and b2415 and b2416 and b4194
SBTptspp D-sorbitol transport via PEP:Pyr PTS (periplasm) b2416 and b2704 and b2703 and b2702 and b2415
FRUptspp D-fructose transport via PEP:Pyr PTS (periplasm) b2415 and b2167 and b2169 and b2416
MANGLYCptspp 2-O-alpha-mannosyl-D-glycerate transport via PEP:Pyr PTS (periplasm) b2415 and b0731 and b2416
MNLptspp mannitol transport via PEP:Pyr PTS (periplasm) (b2415 and b3599 and b2416) or (b2415 and b2934 and b2933 and b2416) or (b2415 and b2704 and b2702 and b2703 and b2416)
GALTptspp Galactitol transport via PEP:Pyr PTS (periplasm) b2092 and b2415 and b2094 and b2093 and b2416
GLCptspp D-glucose transport via PEP:Pyr PTS (periplasm) (b1621 and b2415 and b2417 and b2416) or (b1101 and b2416 and b2415 and b2417) or (b1819 and b2415 and b1818 and b1817 and b2416)
ACMUMptspp N-acetylmuramate transport via PEP:Pyr PTS (periplasm) b2417 and b2416 and b2415 and b2429
MANptspp D-mannose transport via PEP:Pyr PTS (periplasm) b1819 and b1818 and b1817 and b2416 and b2415
CELBpts cellobiose transport via PEP:Pyr PTS (b2715 and b2416 and b2415) or (b2416 and (b1738 and b1737 and b1736) and b2415)
MALTptspp maltose transport via PEP:Pyr PTS (periplasm) b1621 and b2417 and b2415 and b2416
FRUpts2pp Fructose transport via PEP:Pyr PTS (f6p generating) (periplasm) b1818 and b1817 and b2416 and b1819 and b2415
GAMptspp D-glucosamine transport via PEP:Pyr PTS (periplasm) b2415 and b2416 and b1819 and b1817 and b1818
ARBTptspp arbutin transport via PEP:Pyr PTS (periplasm) (b3722 and b2416 and b2415) or (b2715 and b2416 and b2415)
CHTBSptspp chitobiose transport via PEP:Pyr PTS (periplasm) (b1738 and b1737 and b1736) and b2415 and b2416
2DGLCptspp 2-Deoxy-D-glucose transport via PEP:Pyr PTS (periplasm) b2415 and b1817 and b1819 and b2416 and b1818