BiGG Gene b3610

b3610

grxC

Model: iML1515
Position: 3784191 - 3784442
Strand: Minus
Chromosome: NC_000913.3

Protein Sequence

MANVEIYTKETCPYCHRAKALLSSKGVSFQELPIDGNAAKREEMIKRSGRTTVPQIFIDAQHIGGCDDLYALDARGGLDPLLK

DNA Sequence

ATGGCCAATGTTGAAATCTATACCAAAGAAACCTGCCCGTATTGCCATCGTGCAAAAGCACTGCTGAGCAGCAAGGGCGTGAGTTTCCAGGAGCTGCCGATCGATGGCAACGCCGCCAAGCGTGAAGAGATGATCAAACGCAGCGGTCGCACCACGGTTCCCCAGATTTTTATTGACGCACAGCACATTGGCGGCTGTGATGACTTGTATGCATTGGATGCACGTGGTGGACTGGATCCCCTGCTGAAATAA

Associated reactions

BiGG ID	Name	Gene reaction rule
__iML1515__RNDR3b	ribonucleoside-diphosphate reductase (CDP) (glutaredoxin)	(b0849 and (b2675 and b2676)) or ((b2675 and b2676) and b3610) or ((b2675 and b2676) and b1064) or ((b2675 and b2676) and b1654)
__iML1515__RNDR4b	ribonucleoside-diphosphate reductase (UDP) (glutaredoxin)	(b0849 and (b2675 and b2676)) or ((b2675 and b2676) and b3610) or ((b2675 and b2676) and b1654) or ((b2675 and b2676) and b1064)
__iML1515__PAPSR2	phosphoadenylyl-sulfate reductase (glutaredoxin)	(b3610 and b2762) or (b0849 and b2762) or (b1064 and b2762) or (b1654 and b2762)
__iML1515__GRXR	glutaredoxin reductase	b1064 or b3610 or b1654 or b0849
__iML1515__RNDR1b	ribonucleoside-diphosphate reductase (ADP) (glutaredoxin)	((b2675 and b2676) and b1064) or ((b2675 and b2676) and b3610) or (b0849 and (b2675 and b2676)) or ((b2675 and b2676) and b1654)
__iML1515__RNDR2b	ribonucleoside-diphosphate reductase (GDP) (glutaredoxin)	(b0849 and (b2675 and b2676)) or ((b2675 and b2676) and b1064) or ((b2675 and b2676) and b1654) or ((b2675 and b2676) and b3610)