BiGG Gene b3781

b3781

trxA

Model: iML1515
Position: 3965761 - 3966090
Strand: Plus
Chromosome: NC_000913.3

Protein Sequence

MSDKIIHLTDDSFDTDVLKADGAILVDFWAEWCGPCKMIAPILDEIADEYQGKLTVAKLNIDQNPGTAPKYGIRGIPTLLLFKNGEVAATKVGALSKGQLKEFLDANLA

DNA Sequence

ATGAGCGATAAAATTATTCACCTGACTGACGACAGTTTTGACACGGATGTACTCAAAGCGGACGGGGCGATCCTCGTCGATTTCTGGGCAGAGTGGTGCGGTCCGTGCAAAATGATCGCCCCGATTCTGGATGAAATCGCTGACGAATATCAGGGCAAACTGACCGTTGCAAAACTGAACATCGATCAAAACCCTGGCACTGCGCCGAAATATGGCATCCGTGGTATCCCGACTCTGCTGCTGTTCAAAAACGGTGAAGTGGCGGCAACCAAAGTGGGTGCACTGTCTAAAGGTCAGTTGAAAGAGTTCCTCGACGCTAACCTGGCGTAA

Associated reactions

BiGG ID	Name	Gene reaction rule
__iML1515__RNDR1	ribonucleoside-diphosphate reductase (ADP)	(b2582 and (b2234 and b2235)) or (b3781 and (b2234 and b2235))
__iML1515__RNDR3	ribonucleoside-diphosphate reductase (CDP)	(b3781 and (b2234 and b2235)) or (b2582 and (b2234 and b2235))
__iML1515__RNDR4	ribonucleoside-diphosphate reductase (UDP)	(b3781 and (b2234 and b2235)) or ((b2234 and b2235) and b2582)
__iML1515__TRDR	thioredoxin reductase (NADPH)	(b0888 and b3781) or (b2582 and b0888)
__iML1515__PAPSR	phosphoadenylyl-sulfate reductase (thioredoxin)	(b2582 and b2762) or (b3781 and b2762)
__iML1515__METSOXR1	L-methionine-S-oxide reductase	(b2582 and b4219) or (b3781 and b4219) or (b3551 and b2582) or (b3551 and b3781)
__iML1515__METSOXR2	L-methionine-R-sulfoxide reductase	(b2582 and b1778) or (b3781 and b1778) or (b1832 and b3781) or (b1832 and b2582)
__iML1515__RNDR2	ribonucleoside-diphosphate reductase (GDP)	(b3781 and (b2234 and b2235)) or (b2582 and (b2234 and b2235))
__iML1515__THIORDXi	hydrogen peroxide reductase (thioredoxin)	(b3781 and b2480) or b1710 or (b2582 and b2480)
__iML1515__DSBDR	DsbD reductase	(b2582 and b4136) or (b3781 and b4136)